GM-CSF enhances a CpG-independent pathway of neutrophil activation triggered by bacterial DNA

We have previously demonstrated that bacterial DNA induces neutrophil activation through a CpG- and TLR9-independent but MyD88-dependent-pathway. In this study we determined that GM-CSF enhances the activation of neutrophils by bacterial DNA. Granulocyte-macrophage colony-stimulating factor increase...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Bass, J.I.F., Alvarez, M.E., Gabelloni, M.L., Vermeulen, M.E., Amaral, M.M., Geffner, J.R., Trevani, A.S.
Formato:	JOUR
Materias:	Bacterial DNA CpG GM-CSF Inflammation MAPK Neutrophil bacterial DNA CD11b antigen granulocyte macrophage colony stimulating factor interleukin 1beta interleukin 8 mitogen activated protein kinase mitogen activated protein kinase 1 mitogen activated protein kinase 3 mitogen activated protein kinase p38 myeloid differentiation factor 88 oligodeoxynucleotide derivative phosphorothioic acid plasmid DNA single stranded DNA toll like receptor 9 animal experiment article controlled study CpG island cytokine release DNA methylation enzyme activation human human cell leukocyte activation male mouse nonhuman priority journal upregulation Animals Antigens, CD11b CpG Islands DNA, Bacterial Enzyme Activation Extracellular Signal-Regulated MAP Kinases Granulocyte-Macrophage Colony-Stimulating Factor Humans Interleukin-8 Mice Mice, Inbred C57BL Myeloid Differentiation Factor 88 Neutrophil Activation Neutrophils NF-kappa B p38 Mitogen-Activated Protein Kinases Bacteria (microorganisms)
Acceso en línea:	http://hdl.handle.net/20.500.12110/paper_01615890_v46_n1_p37_Bass
Aporte de:	Biblioteca Digital - Facultad de Ciencias Exactas y Naturales (UBA) de Universidad de Buenos Aires

id	todo:paper_01615890_v46_n1_p37_Bass
record_format	dspace
spelling	todo:paper_01615890_v46_n1_p37_Bass2023-10-03T15:01:21Z GM-CSF enhances a CpG-independent pathway of neutrophil activation triggered by bacterial DNA Bass, J.I.F. Alvarez, M.E. Gabelloni, M.L. Vermeulen, M.E. Amaral, M.M. Geffner, J.R. Trevani, A.S. Bacterial DNA CpG GM-CSF Inflammation MAPK Neutrophil bacterial DNA CD11b antigen granulocyte macrophage colony stimulating factor interleukin 1beta interleukin 8 mitogen activated protein kinase mitogen activated protein kinase 1 mitogen activated protein kinase 3 mitogen activated protein kinase p38 myeloid differentiation factor 88 oligodeoxynucleotide derivative phosphorothioic acid plasmid DNA single stranded DNA toll like receptor 9 animal experiment article controlled study CpG island cytokine release DNA methylation enzyme activation human human cell leukocyte activation male mouse nonhuman priority journal upregulation Animals Antigens, CD11b CpG Islands DNA, Bacterial Enzyme Activation Extracellular Signal-Regulated MAP Kinases Granulocyte-Macrophage Colony-Stimulating Factor Humans Interleukin-8 Mice Mice, Inbred C57BL Myeloid Differentiation Factor 88 Neutrophil Activation Neutrophils NF-kappa B p38 Mitogen-Activated Protein Kinases Bacteria (microorganisms) We have previously demonstrated that bacterial DNA induces neutrophil activation through a CpG- and TLR9-independent but MyD88-dependent-pathway. In this study we determined that GM-CSF enhances the activation of neutrophils by bacterial DNA. Granulocyte-macrophage colony-stimulating factor increased IL-8 and IL-1β secretion, and CD11b-upregulation induced by single-stranded bacterial DNA. It also enhanced neutrophil IL-8 production induced by double-stranded bacterial DNA, methylated single-stranded DNA, plasmid DNA, and phosphorothioated-CpG and non-CpG-oligodeoxynucleotides. Together these observations indicated that GM-CSF enhances neutrophil responses triggered by bacterial DNA in a CpG-independent fashion. We also found that GM-CSF enhanced the activation of the MAPKs p38 and ERK1/2 induced by bacterial DNA. Moreover, the pharmacological inhibition of these pathways significantly diminished GM-CSF ability to increase neutrophil activation by bacterial DNA. Finally, we observed that GM-CSF was unable to increase the activation of MyD88-/- neutrophils by bacterial DNA. Our findings suggest that GM-CSF modulates the CpG-independent, MyD88-dependent neutrophil response to bacterial DNA, by increasing the activation of the MAPKs p38 and ERK1/2. © 2008 Elsevier Ltd. All rights reserved. Fil:Gabelloni, M.L. Universidad de Buenos Aires. Facultad de Ciencias Exactas y Naturales; Argentina. Fil:Vermeulen, M.E. Universidad de Buenos Aires. Facultad de Ciencias Exactas y Naturales; Argentina. Fil:Amaral, M.M. Universidad de Buenos Aires. Facultad de Ciencias Exactas y Naturales; Argentina. Fil:Trevani, A.S. Universidad de Buenos Aires. Facultad de Ciencias Exactas y Naturales; Argentina. JOUR info:eu-repo/semantics/openAccess http://creativecommons.org/licenses/by/2.5/ar http://hdl.handle.net/20.500.12110/paper_01615890_v46_n1_p37_Bass
institution	Universidad de Buenos Aires
institution_str	I-28
repository_str	R-134
collection	Biblioteca Digital - Facultad de Ciencias Exactas y Naturales (UBA)
topic	Bacterial DNA CpG GM-CSF Inflammation MAPK Neutrophil bacterial DNA CD11b antigen granulocyte macrophage colony stimulating factor interleukin 1beta interleukin 8 mitogen activated protein kinase mitogen activated protein kinase 1 mitogen activated protein kinase 3 mitogen activated protein kinase p38 myeloid differentiation factor 88 oligodeoxynucleotide derivative phosphorothioic acid plasmid DNA single stranded DNA toll like receptor 9 animal experiment article controlled study CpG island cytokine release DNA methylation enzyme activation human human cell leukocyte activation male mouse nonhuman priority journal upregulation Animals Antigens, CD11b CpG Islands DNA, Bacterial Enzyme Activation Extracellular Signal-Regulated MAP Kinases Granulocyte-Macrophage Colony-Stimulating Factor Humans Interleukin-8 Mice Mice, Inbred C57BL Myeloid Differentiation Factor 88 Neutrophil Activation Neutrophils NF-kappa B p38 Mitogen-Activated Protein Kinases Bacteria (microorganisms)
spellingShingle	Bacterial DNA CpG GM-CSF Inflammation MAPK Neutrophil bacterial DNA CD11b antigen granulocyte macrophage colony stimulating factor interleukin 1beta interleukin 8 mitogen activated protein kinase mitogen activated protein kinase 1 mitogen activated protein kinase 3 mitogen activated protein kinase p38 myeloid differentiation factor 88 oligodeoxynucleotide derivative phosphorothioic acid plasmid DNA single stranded DNA toll like receptor 9 animal experiment article controlled study CpG island cytokine release DNA methylation enzyme activation human human cell leukocyte activation male mouse nonhuman priority journal upregulation Animals Antigens, CD11b CpG Islands DNA, Bacterial Enzyme Activation Extracellular Signal-Regulated MAP Kinases Granulocyte-Macrophage Colony-Stimulating Factor Humans Interleukin-8 Mice Mice, Inbred C57BL Myeloid Differentiation Factor 88 Neutrophil Activation Neutrophils NF-kappa B p38 Mitogen-Activated Protein Kinases Bacteria (microorganisms) Bass, J.I.F. Alvarez, M.E. Gabelloni, M.L. Vermeulen, M.E. Amaral, M.M. Geffner, J.R. Trevani, A.S. GM-CSF enhances a CpG-independent pathway of neutrophil activation triggered by bacterial DNA
topic_facet	Bacterial DNA CpG GM-CSF Inflammation MAPK Neutrophil bacterial DNA CD11b antigen granulocyte macrophage colony stimulating factor interleukin 1beta interleukin 8 mitogen activated protein kinase mitogen activated protein kinase 1 mitogen activated protein kinase 3 mitogen activated protein kinase p38 myeloid differentiation factor 88 oligodeoxynucleotide derivative phosphorothioic acid plasmid DNA single stranded DNA toll like receptor 9 animal experiment article controlled study CpG island cytokine release DNA methylation enzyme activation human human cell leukocyte activation male mouse nonhuman priority journal upregulation Animals Antigens, CD11b CpG Islands DNA, Bacterial Enzyme Activation Extracellular Signal-Regulated MAP Kinases Granulocyte-Macrophage Colony-Stimulating Factor Humans Interleukin-8 Mice Mice, Inbred C57BL Myeloid Differentiation Factor 88 Neutrophil Activation Neutrophils NF-kappa B p38 Mitogen-Activated Protein Kinases Bacteria (microorganisms)
description	We have previously demonstrated that bacterial DNA induces neutrophil activation through a CpG- and TLR9-independent but MyD88-dependent-pathway. In this study we determined that GM-CSF enhances the activation of neutrophils by bacterial DNA. Granulocyte-macrophage colony-stimulating factor increased IL-8 and IL-1β secretion, and CD11b-upregulation induced by single-stranded bacterial DNA. It also enhanced neutrophil IL-8 production induced by double-stranded bacterial DNA, methylated single-stranded DNA, plasmid DNA, and phosphorothioated-CpG and non-CpG-oligodeoxynucleotides. Together these observations indicated that GM-CSF enhances neutrophil responses triggered by bacterial DNA in a CpG-independent fashion. We also found that GM-CSF enhanced the activation of the MAPKs p38 and ERK1/2 induced by bacterial DNA. Moreover, the pharmacological inhibition of these pathways significantly diminished GM-CSF ability to increase neutrophil activation by bacterial DNA. Finally, we observed that GM-CSF was unable to increase the activation of MyD88-/- neutrophils by bacterial DNA. Our findings suggest that GM-CSF modulates the CpG-independent, MyD88-dependent neutrophil response to bacterial DNA, by increasing the activation of the MAPKs p38 and ERK1/2. © 2008 Elsevier Ltd. All rights reserved.
format	JOUR
author	Bass, J.I.F. Alvarez, M.E. Gabelloni, M.L. Vermeulen, M.E. Amaral, M.M. Geffner, J.R. Trevani, A.S.
author_facet	Bass, J.I.F. Alvarez, M.E. Gabelloni, M.L. Vermeulen, M.E. Amaral, M.M. Geffner, J.R. Trevani, A.S.
author_sort	Bass, J.I.F.
title	GM-CSF enhances a CpG-independent pathway of neutrophil activation triggered by bacterial DNA
title_short	GM-CSF enhances a CpG-independent pathway of neutrophil activation triggered by bacterial DNA
title_full	GM-CSF enhances a CpG-independent pathway of neutrophil activation triggered by bacterial DNA
title_fullStr	GM-CSF enhances a CpG-independent pathway of neutrophil activation triggered by bacterial DNA
title_full_unstemmed	GM-CSF enhances a CpG-independent pathway of neutrophil activation triggered by bacterial DNA
title_sort	gm-csf enhances a cpg-independent pathway of neutrophil activation triggered by bacterial dna
url	http://hdl.handle.net/20.500.12110/paper_01615890_v46_n1_p37_Bass
work_keys_str_mv	AT bassjif gmcsfenhancesacpgindependentpathwayofneutrophilactivationtriggeredbybacterialdna AT alvarezme gmcsfenhancesacpgindependentpathwayofneutrophilactivationtriggeredbybacterialdna AT gabelloniml gmcsfenhancesacpgindependentpathwayofneutrophilactivationtriggeredbybacterialdna AT vermeulenme gmcsfenhancesacpgindependentpathwayofneutrophilactivationtriggeredbybacterialdna AT amaralmm gmcsfenhancesacpgindependentpathwayofneutrophilactivationtriggeredbybacterialdna AT geffnerjr gmcsfenhancesacpgindependentpathwayofneutrophilactivationtriggeredbybacterialdna AT trevanias gmcsfenhancesacpgindependentpathwayofneutrophilactivationtriggeredbybacterialdna
_version_	1807319714290991104

GM-CSF enhances a CpG-independent pathway of neutrophil activation triggered by bacterial DNA

Ejemplares similares